PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g075760.1
Common NameMTR_5g075760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 217aa    MW: 24942 Da    PI: 7.4317
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g075760.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-17106149347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       WT+eE+ l++++++ +G+g Wk+I++++  +Rt+ q+ s+ qk+
  Medtr5g075760.1 106 HWTEEEHRLFLEGIEIHGKGKWKLISQHVR-TRTASQVASHAQKH 149
                      6*****************************.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.075559IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.9E-5860IPR009057Homeodomain-like
SMARTSM007170.012961IPR001005SANT/Myb domain
SuperFamilySSF466896.5E-71166IPR009057Homeodomain-like
CDDcd001671.21E-41259No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1298152IPR009057Homeodomain-like
PROSITE profilePS5129420.52999154IPR017930Myb domain
SMARTSM007172.5E-11103152IPR001005SANT/Myb domain
SuperFamilySSF466895.68E-16105153IPR009057Homeodomain-like
PfamPF002496.7E-15106149IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.4E-12106153IPR006447Myb domain, plants
CDDcd001673.12E-12107150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MNDPNNDGKS KEWTWDENKI FETILFEYLE EVQEGRWENI GLVCGRSSTE VKEHYETLLH  60
DLALIEEGLV DFSTNSDDFI ISKASTDENK APPTKNKTKK VVRVKHWTEE EHRLFLEGIE  120
IHGKGKWKLI SQHVRTRTAS QVASHAQKHF LHQLDGTSKK TYKKRSNFYI TSLKGNSKPL  180
LNKDNIPSPS TSWDGNFHPL LYKDNYVPAL PSPHLN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1468420.0AC146842.9 Medicago truncatula clone mth2-10a3, complete sequence.
GenBankAC1496000.0AC149600.8 Medicago truncatula strain A17 clone mte1-41j24, complete sequence.
GenBankCU4590320.0CU459032.2 Medicago truncatula chromosome 5 clone mth4-20f20, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616068.21e-160myb transcription factor
TrEMBLG7K5U51e-160G7K5U5_MEDTR; Myb transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2055925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-24MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]